PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.009G166100.2
Common NameB456_009G166100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family ARF
Protein Properties Length: 739aa    MW: 80555.9 Da    PI: 7.4217
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.009G166100.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B377.41.5e-24147248199
                         EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE- CS
                  B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkld 85 
                         f+k+lt sd++++g +++p++ ae++      + +++ s++l+ +d++g +W++++iyr++++r++lt+GW+ Fv+ ++L +gD v+F   
  Gorai.009G166100.2 147 FCKTLTASDTSTHGGFSVPRRAAEDCfppldyN-QQRPSQELVAKDLHGLEWRFRHIYRGQPRRHLLTTGWSAFVNKKKLVSGDAVLFL-- 234
                         99****************************963.3445679************************************************.. PP

                         SSSEE..EEEEE-S CS
                  B3  86 grsefelvvkvfrk 99 
                         + +++el+++++r+
  Gorai.009G166100.2 235 RGENGELRLGIRRA 248
                         4499999****996 PP

2Auxin_resp120.31.5e-39273354182
          Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                         ++ha+s+ksvF+++YnPras+seF+++v+k+ k+l++++svGmRfkm+fe+ed++e r++G+v+g+s++dpvrW++SkWr+L
  Gorai.009G166100.2 273 VVHAISMKSVFSIYYNPRASSSEFIIPVHKFWKSLDHSFSVGMRFKMRFESEDAAEGRYTGVVTGISEMDPVRWSGSKWRCL 354
                         689******************************************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.57E-42140257IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.8E-40141251IPR015300DNA-binding pseudobarrel domain
CDDcd100171.33E-22145247No hitNo description
PfamPF023621.9E-22147248IPR003340B3 DNA binding domain
SMARTSM010191.2E-23147249IPR003340B3 DNA binding domain
PROSITE profilePS5086313.549147249IPR003340B3 DNA binding domain
PfamPF065073.7E-34273354IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 739 aa     Download sequence    Send to blast
MGGLIDLNTT EDEETPSSGS LSPSSSSASV LSASGSASSS PVCLELWHAC AGPLISLPKR  60
GSVVVYFPQG HLQQVSDFSG VAPAHDLPPH VFCRVVDVKL HAEGATDEVY AQVSLVPENE  120
KLKEGNIEVD GEEDAEADIK STTPHMFCKT LTASDTSTHG GFSVPRRAAE DCFPPLDYNQ  180
QRPSQELVAK DLHGLEWRFR HIYRGQPRRH LLTTGWSAFV NKKKLVSGDA VLFLRGENGE  240
LRLGIRRAAH IKNGTSFHSL CTQQLNRSNF ADVVHAISMK SVFSIYYNPR ASSSEFIIPV  300
HKFWKSLDHS FSVGMRFKMR FESEDAAEGR YTGVVTGISE MDPVRWSGSK WRCLLVRWDD  360
IDANRHNRVS PWEIEPSSSI SSSNSLLSPG SKRNRVGLPS GKPEFMVPEG IGASDFGESL  420
RFQKVLQGQE ILGFNTHHDG ANSQIMHRSE ISRRFPCSNG SGIAAIRNIG RDTLVNPDIS  480
YKGVGFEESF RFQKVLQGQE TSVSPPCRRG PTADDTRESD SPGAPDVGQL SGTRSGWSSL  540
MQSYNTHSHI GPSAQVSSPS SVLKFQHASN PFANVNPIHN LNSQEKERRV HKSSSFHAPE  600
TYGDRIPSST GGHGSRRRHL GSLDSFGPSA DTVQLGDSQP LSAQPTFRTS QELASSCKSS  660
CRLFGFSLTE GGHDAAKEDN MVQATSSLGA GAFLPRIGEQ FNTQPPAVTN TVGSSYTKVP  720
PIRSCVYTGF WSLMNMML*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldy_A1e-1193538312361Auxin response factor 1
4ldy_B1e-1193538312361Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012444770.10.0PREDICTED: auxin response factor 3 isoform X5
SwissprotO236610.0ARFC_ARATH; Auxin response factor 3
TrEMBLA0A0D2UNF10.0A0A0D2UNF1_G
STRINGVIT_10s0003g00420.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33860.10.0ARF family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]